PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_26708_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 306aa    MW: 34178.6 Da    PI: 8.4074
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_26708_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++  v+ +G g+W++++++ g++R++k+c++rw +yl
   Neem_26708_f_2 14 RGLWTPEEDAKILAHVANHGIGNWTSVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding51.42.5e-1668110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+e++++++k  G++ W++Ia++++ gRt++++k++w++
   Neem_26708_f_2  68 DNFTPQEEEIIINLHKAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.405965IPR017930Myb domain
SuperFamilySSF466898.8E-3111108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001671.54E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2565116IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.02766116IPR017930Myb domain
PfamPF002491.5E-1469110IPR001005SANT/Myb domain
CDDcd001674.77E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRPPCCNKS NVKRGLWTPE EDAKILAHVA NHGIGNWTSV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPQEEEIIIN LHKAIGSRWS LIAKRLPGRT DNDVKNYWNT KLKKKLSNMG  120
IDPVTHKPIS QLLSDYGNIS GNISINTAKH FGNKNLKNTL FSKPETLSVQ DHSSVTTCNP  180
VCDFMPHFFS TEIASSCSSS SSSAQISPPS PFSWTEFLVS DPIFSMDLQQ QIQPKLDVML  240
PQTNSNLTEN KIPSFDFIGA YNSRSHNGNQ VNADSPSAGS FVDDILSKDR EMCSHSFQLL  300
DGFLEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
1h8a_C3e-271411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431044.11e-116hypothetical protein CICLE_v10013340mg
SwissprotQ9LSI75e-87MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A067GAK31e-116A0A067GAK3_CITSI; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-85MYB family protein